Project origin demo mediafire jobs

Filtruj

Moje ostatnie wyszukiwania
Pokaż:
Budżet
dla
dla
dla
Typ
Umiejętności
Języki
    Stan Projektu
    12,685 project origin demo mediafire znalezione projekty, cennik w USD

    ...modyfikacji. Czy podjąłby się Pan powyższego? Oczywiście demo skryptu chętnie mogę udostępnić oraz dostępy FTP, mySQL. Przesyłam jeszcze listę serwisów które chciałbym podłączyć (większość ma API, wiec to nie dużo pracy) : [login to view URL] filefactory [login to view URL] (jest, wymaga aktualizacji) [login to view URL] mediafire rapidgator [login to view URL] [l...

    $484 (Avg Bid)
    $484 Średnia Oferta:
    3 składanie ofert

    Demo gry mobilnej pokazujące koncepcje gry w formie aplikacji-strona główna + 3 pierwsze plansze z użyciem Augmentent Reality czas realizacji: do 1 kwietnia 2017

    $2231 (Avg Bid)
    $2231 Średnia Oferta:
    8 składanie ofert

    Obecnie user po wypełnienieu formularza dostaje email z podziekowaniem za pobranie wersji demo która pobiera sie automatycznie po wypelnieniu formularza. Chciałbym dodać do tego maila jeszcze link bezpośredni do wersji demo. Link zależy od wybranej w formularzu wersji programu.

    $17 (Avg Bid)
    $17 Średnia Oferta:
    4 składanie ofert

    Need European advertisers for placing ads for our company. The project is for 10 ads per item, a total of 150 ads on classifieds websites, top on your countries origin. Potrzebujesz europejskich reklamodawców do umieszczania reklam dla naszej [login to view URL] jest na 10 pozycji, reklam na łącznie 150 reklam na stronach internetowych, w górnej ogłoszeniowych

    $2827 (Avg Bid)
    $2827 Średnia Oferta:
    2 składanie ofert

    Witam! Potrzebuję kogoś, kto szybko i sprwnie wykona stronę internetową mojej firmy. Posiadam dokładny wzór na którym można się oprzeć [login to view URL] Z tym, ze ilośc kwadratów ma by ograniczona do trzech rzędów. Mam też przygotowane wszystkie grafiki i teksty- tak naprawdę chodzi tylko o złożenie tego w całość, bez

    $146 (Avg Bid)
    $146 Średnia Oferta:
    7 składanie ofert

    Wsparcie przy tworzeniu aplikacji demo na Android-a dla startap-u. Na początku wsparcie/konsultacje przy tworzeniu podstaw jak widok listy, logowanie. Zamierzam wstępnie przeznaczyć 150zł. Proszę o kontakt osoby w okolicy Gliwic, Katowic.

    $922 (Avg Bid)
    $922 Średnia Oferta:
    1 składanie ofert

    Witam, Zaistniała potrzeba aby działająca strona www oparta na Joomla 1.5 wraz w VirtueMart została wykorzystana jako Demo CD/DVD. Obecnie jest to katalog produktów i to jest w całym pomyśle kluczowe. Są różne sposoby aby serwis przenieść na CD/DVD czy też nawet PenDrive, np. JAMP, movAMP, itp. i byłoby to pożądane rozwiązanie poza jednym kluczowym

    min $3
    min $3
    0 składanie ofert

    ...wyszukiwarki google chodzi mi wyłącznie o napisanie grafiki podobnej do tej strony [login to view URL] plus grafika dla wyszukiwań [login to view URL];mc=suche%40web%[login to view URL]%40web&allparams=&smode=&su=dom&search=Suche...

    min $3
    min $3
    0 składanie ofert

    Witam. Kupię skrypt najlepiej gotowy z bazą telefonów komórkowych i inne związane z tą tematyką. Proszę o kontakt i oferty związane z tworzeniem od początku bądź gotowych już skryptów z tematyką KOMÓREK. Przykład: [login to view URL]

    min $3
    min $3
    0 składanie ofert

    Należy wykonać prosty projekt demo ilustrujący działanie JMS - rozproszonego systemu wykonywania " zadań" zgłaszanych przez użytkowników. Użytkownik przez klienta ad hoc może zgłosić "Job" (jakikolwiek obiekt typu serializable z zaimplementowanym interfejsem Runable). System decyduje, który z serwerów powinien wykonać prace

    min $3
    min $3
    0 składanie ofert

    Zlecę wykonanie demo serwisu wymiany płodów rolnych podobnego jak demo [login to view URL] UWAGA!!! Proszę wyłącznie o oferty osób zamieszkałych w Warszawie.

    min $3
    min $3
    0 składanie ofert

    Witam, zlecę wykonanie profesjonalnej wizualizacji mieszkania o powierzchni do 45 m2. *O projekcie Planuję uruchomić nową usługę, wizualizacji wnętrz nieruchomości. *Budżet Chciałbym zmieścić się w 1500 - 2000 złotych, chociaż wiem że wykonanie takiej wizualizacji oscyluje w kosztach 2500 i więcej. *Wraz z uruchomieniem oferty, jestem w stanie zaoferować stałą współpracę, za nie...

    min $3
    min $3
    0 składanie ofert

    Witam, zlecę wykonanie profesjonalnej wizualizacji mieszkania o powierzchni do 45 m2. *O projekcie Planuję uruchomić nową usługę, wizualizacji wnętrz nieruchomości. *Budżet Chciałbym zmieścić się w 1500 - 2000 złotych, chociaż wiem że wykonanie takiej wizualizacji oscyluje w kosztach 2500 i więcej. *Wraz z uruchomieniem oferty, jestem w stanie zaoferować stałą współpracę, za nie...

    min $3
    min $3
    0 składanie ofert

    ...grafika musi powalac- to nie moze byc wklejone zdjecie w topie i juz- najlepiej aby byla full flash. Najwazniejsze jest jednak, aby osoba , ktora podejmie sie projektu wykonala demo lub intro do strony, ewentualnie jedna podstrone na juz!! Chodzi o pokazanie czegos klientowi jak najszybciej, a na wykonanie calej strony wowczas bedziemy mieli sporo czasu

    min $3
    min $3
    0 składanie ofert

    Witam Celem zlecenia jest projekt, a mianowicie slownik polsko-angielski z baza slow w notatniku. Program ma podawac znaczenie angielskie i "czytac go" - czytanie moze to byc po prostu odtworzony plik dzwiekowy np. mp3. Projket ma byc wykonany w c++, chcialbym go otrzymac w wersji projektu [login to view URL] studio 6 i gotowy plik wykonawczy wraz z jedny plikiem dzwikowym. Szczeg...

    $29 (Avg Bid)
    $29 Średnia Oferta:
    1 składanie ofert

    Witam Celem zlecenia jest projekt zaliczeniowy a mianowicie slownik polsko-angielski z baza slow w notatniku. Program ma podawac znaczenie angielskie i "czytac go" - czytanie moze to byc po prostu odtworzony plik dzwiekowy np. mp3. Projket ma byc wykonany w c++, chcialbym go otrzymac w wersji projektu [login to view URL] studio 6 i gotowy plik wykonawczy wraz z jedny plikiem dzwikowy...

    min $3
    min $3
    0 składanie ofert

    Witam, Proszę o wycenę i ofertę. Chciałbym zainstalować na serwerze wersję sklepu OScommerce z jakąś ładną szatą graficzną, wstępnie stiuningowanym i gotowym do pracy, zależy mi najbardziej na wprowadzonych towarach, tak żeby sprawiał wrażenie w pełni fukcjonującego. Towary z zakresu sprzętu elektro. Cel tego: zapoznanie się z ehandlem /punkt startowy do dalszych prac/ Pozdrawia Piotr

    min $3
    min $3
    0 składanie ofert

    ...Tchesio hits the road again, serious: On his trip from Nowy Sącz to Lisbon which is m kilometres long there are n gas stations at distance a[1]<a[2]<...<a[n] from the origin. The tank has capacity c litres and the machine burns p litres per 100 kilometers. Compute the minimum number of stops that Tchesio has to make, and list the numbers of stations

    $3 - $18
    $3 - $18
    0 składanie ofert

    ...dowolnego frameworka (najlepiej jak najprostszego) opierającego się o wzorzec Model-View-Controler (wyrazny podzial na model, interfejs, funkcje sterujace). Projekt ma byc wersja demo, dlatego funkcjonalnosc do niego bedzie ograniczona do minimum, czyli: - w systemie mamy jednego uzytkownika - bedzie nim kasjer - kasjer przyjmuje zamowienie od klienta (zamowienie

    $146 (Avg Bid)
    $146 Średnia Oferta:
    1 składanie ofert

    Poszukujemy do stałej współpracy osoby wykonującej dema lub helpy prezentujące możliwości oprogramowania w formie animowanego we flashu filmu. Mile widziane wykorzystanie profesjonalnego oprogramowania do tego typu zadań w stylu np: a) [login to view URL] b) [login to view URL] c) [login to view URL] d) inne rekomendowane .... Koszty zakupu licencji na oprogramowanie oczywiście ...

    min $3
    min $3
    0 składanie ofert

    Wymagania: 0)wymagam udostepnienia kodu zrodlowego dla aplikacji 1)Koniecznie musi byc napisane pod VC++ 2)Koniecznie DirectX w wersji 9. 3)Program ma wczytac z pliku wspolrzedne punktow szescianu 4)A nastepnie prostego terenu 5)Format danych - plik tekstowy o formacie: x1 y1 z1 x2 y2 y3 itd. 6)Szescianowi oraz bryle terenu nalezy nadac wlasciwosci fizyczne takie jak: a)masa b)...

    $3 - $29
    $3 - $29
    0 składanie ofert
    Discourse Plugin Update 6 days left
    ZWERYFIKOWANY

    ...- Shows - Already up-to-date. (not pulling any information) Then when i rebuild it fails ./launcher rebuild app Error is below Ensuring launcher is up to date Fetching origin Launcher is up-to-date Stopping old container /usr/bin/docker stop -t 10 app app cd /pups && git pull && /pups/bin/pups --stdin Already up-to-date. I, [2018-09-23T06:07:01

    $37 (Avg Bid)
    $37 Średnia Oferta:
    4 składanie ofert

    I need someone who is a specialist in speed optimization for shopify to make this site fast and must edit code. Attached is a report th...Defer offscreen images 3. Minify CSS Potential 4. Minify JavaScript 5. Defer unused CSS 6. Serve images in next-gen formats 7. Avoid multiple, costly round trips to any origin 8. Preload key requests Potential

    $156 (Avg Bid)
    $156 Średnia Oferta:
    5 składanie ofert
    Report Project 6 days left
    ZWERYFIKOWANY

    Write a report that provides facts about various project method methodologies. The audience for your report is your senior leadership. Include the following: 1. Provide an overview of your organization and the project management methodology you currently use (Traditional/Waterfall, Agile, Lean, etc.). You may also use a company you wish to work for

    $47 (Avg Bid)
    $47 Średnia Oferta:
    27 składanie ofert

    1) we need someone help us choose doma...thats available for a free lancer slah fiver type site we are launching, i 2) we need someone to install the micro job engine theme for wordpress 3) we need someone to edit demo content in theme, 4) we need someone to intergrate stripe payment option 5) we need someone to install ssl certificate for site

    $39 (Avg Bid)
    $39 Średnia Oferta:
    11 składanie ofert

    ...learn more, visit aerotek.com. The company is an equal opportunity employer and will consider all applications without regards to race, sex, age, color, religion, national origin, veteran status, disability, sexual orientation, gender identity, genetic information or any characteristic protected by law. Job Overview: Global Electronic Distribution

    $33 / hr (Avg Bid)
    $33 / hr Średnia Oferta:
    28 składanie ofert

    Pa...PatronArt provides equal employment opportunities with consideration to an inclusive and innovative environment, without regard to race, color, religion, gender, age, national origin, disability, sexual orientation, gender identity, veteran status or any other protected status in accordance with applicable law. PatronArt participates in E-verify

    $18 (Avg Bid)
    $18 Średnia Oferta:
    4 składanie ofert

    ...sequences. Discuss your answer. (5 marks) Question 3 (a) Solve the identity of the below sequence. Document the steps used to identify the sequence. Name the gene and the origin organism. MDWTWILFLVAAATRVHSTSMDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIRDA YLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSA DRGLVLMPG

    $65 (Avg Bid)
    $65 Średnia Oferta:
    7 składanie ofert

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located after the text "Origin:", before the first comma origin_state --> data located after the text "Origin:", after the first comma ship_date --> data located after the text "Pickup Date", changed to the YYYY-MM-DD...

    $131 (Avg Bid)
    $131 Średnia Oferta:
    14 składanie ofert

    ...The output should be a pipe (|) delimited file with the following column mappings: origin_city --> data located in the "ORIGIN CITY" column origin_state --> data located in the "ST" column to the right of the "ORIGIN CITY" column ship_date --> data located in the "PICKUP DATE" column changed to the YYYY-MM-DD for...

    $145 (Avg Bid)
    $145 Średnia Oferta:
    13 składanie ofert

    We need a working demo of our platform. There are 3 platforms (that are mostly different by skin) all have 75% same functionality. we need a working demo of each one. react frame work - angular JS and Mongo DB (AWS)

    $1231 (Avg Bid)
    $1231 Średnia Oferta:
    28 składanie ofert
    Trophy icon Logo for a Japanese Product 4 days left

    We want a get a logo redesigned to give it a traditional look. The inherent characteristics should be business like and professional with a Japanese origin. The brand is used to market chemicals and pigments in the international markets. The logo has to be of single colour, rusty and traditional. We should be able to screen print the logo on bags and

    $48 (Avg Bid)
    Gwarantowane
    $48
    33 zgłoszenia

    In this project, we have a system consisting of four parts in a visual scene that is to be rendered in the RVIZ tool of ROS. The four parts of our system are the base, robot, camera, and object. Every one of these parts has its own coordinate frame attached to it. We use RVIZ tool for visualization purposes, and in RVIZ, we visualize these parts using

    $30 (Avg Bid)
    $30 Średnia Oferta:
    4 składanie ofert

    ...- 502 (Bad Gateway) :8100/#/checkout/inicio/product:1 Failed to load -------------------------------------------------: No 'Access-Control-Allow-Origin' header is present on the requested resource. Origin 'http://localhost:8100' is therefore not allowed access. The response had HTTP status code 502. If an opaque response serves your needs, set the request'...

    $108 (Avg Bid)
    $108 Średnia Oferta:
    16 składanie ofert

    I want someone who can create a file-sharing website for me. On that website, anyone globally can sign up and upload its file to our server and can easily share its file through a generated link from our website. The website must be responsive and I can able to put ads on that site like in media fire.

    $138 (Avg Bid)
    $138 Średnia Oferta:
    6 składanie ofert

    We are looking for a DApp programmer to build a demo project. We are in Proof of Concept stage and looking for experience programmer for quick job to prove our ideas works. Following with Scope 1. DApp required to query data from our API. We have a sales transaction want to submit on Ether Blockchain. Following with sample data structure and may have

    $270 (Avg Bid)
    $270 Średnia Oferta:
    18 składanie ofert
    Product Promotional Video/Demo 4 days left
    ZWERYFIKOWANY

    I would like to work with a designer to outline and create a product demo which shows the capability and usage our product for demonstration at a conference/convention. The total duration of the demonstration is for 10 mins. We hope to play the product demo and then talk to it and show off the capability of the tool - This can be done in powerpoint

    $422 (Avg Bid)
    $422 Średnia Oferta:
    44 składanie ofert

    I would like to work with a designer to outline and create a product demo which shows the capability and usage our product for demonstration at a conference/convention. This can be done in powerpoint, Prezi, or video.

    $254 (Avg Bid)
    $254 Średnia Oferta:
    23 składanie ofert

    ...page form the 4 hexagon & link to the relavent page when user click the button
- newsletter subscription - social media integration • Learning - Input content “symptoms” & “origin” will show the info when user click the text - input ppt , when user click the ppt, will show the ppt on new tab & allow user to save & download the ppt - Will crea...

    $571 (Avg Bid)
    $571 Średnia Oferta:
    27 składanie ofert
    Upload2Earn 3 days left

    I want a website like mediafire different design i want to make premium upload options too so that people have limit to upload for free and after that they have to pay to upgrade the limit.

    $150 (Avg Bid)
    $150 Średnia Oferta:
    2 składanie ofert

    We require a...these files to be uploaded to our Invision account and to create a working interactive prototype. You will work with our Project Manager on how this Invision prototype will work. The attached files includes the pages for the demo, the template files that include pink are the old design and require being built in the new design (green).

    $1949 (Avg Bid)
    $1949 Średnia Oferta:
    21 składanie ofert

    I bought two prestashop themes. I would like them installed and looking like demo. Install prestashop. That's it. Needed right now. Thank you. Budget $27

    $26 (Avg Bid)
    $26 Średnia Oferta:
    9 składanie ofert

    Want to build a game like clash of clans but with Indian theme. The characters would be from Indian Mythology and from comics related to Indian Origin. Game should work in different platforms(Android & IOS).

    $8 / hr (Avg Bid)
    $8 / hr Średnia Oferta:
    5 składanie ofert

    We have an IOS SDK available which we need to test if it is working properly. And few screens need to be built up as a demo. Its a relatively small and quick task.

    $47 (Avg Bid)
    $47 Średnia Oferta:
    5 składanie ofert

    ...Employment Opportunity employer that does not discriminate against any associate or applicant on the basis of race, creed, color, religion, sex (including pregnancy), age, national origin, physical or mental disability, sexual orientation, marital or familial status, genetic information or other basis protected by law ...

    $155 (Avg Bid)
    $155 Średnia Oferta:
    1 składanie ofert

    I Have A WordPress Theme, And I need To install Tham.

    $21 (Avg Bid)
    $21 Średnia Oferta:
    46 składanie ofert
    $5 / hr Średnia Oferta:
    7 składanie ofert

    We are a successful company looking to employ talented individuals on our team who are self-motivated, positive and energetic....opportunity employer. Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability or protected veteran status.

    $545 (Avg Bid)
    $545 Średnia Oferta:
    18 składanie ofert
    Magento B2B website walk-through+demo 2 days left
    ZWERYFIKOWANY

    ...website developed on Magento 1.9+ platform. Basically, one of my clients wants to have his corporate B2B portal developed completely on Magento but before he awards me the project, he wants to have a look at something similar (with complete, core back-end B2B features and all.) Note: I have intermediate experience of Magento. I am not a developer. I

    $34 / hr (Avg Bid)
    $34 / hr Średnia Oferta:
    21 składanie ofert