Zamknięty

Neuro fuzzy systems

Ten projekt otrzymał 12 ofert od utalentowanych freelancerów ze średnią ceną ofert wynoszącą $280 USD.

Otrzymaj darmowe wyceny do podobnego projektu
Pracodawca pracuje
Budżet Projektu
$30 - $250 USD
Ofert Razem
12
Opis Projektu

I need someone to design a neurofuzzy system for protein secondary structure prediction. Given a protein sequence it should output the secondary sequence of that protein sequence

For example if the protein sequence is KSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG the secondary structure should be CCCHHHCCCCHHHHHHHHHHHCCCCEEEEEECCCCEECCCCCCEEEEEEECCCCEECCCCEEC.

Chcesz zarobić trochę pieniędzy?

  • Napisz kwotę, za jaką jesteś w stanie podjąć się projektu i przedział czasowy, w którym będziesz w stanie go zrealizować
  • Opisz, w jaki sposób wykonasz projekt
  • Otrzymaj wynagrodzenie za pracę

Zatrudnij Freelancerów, którzy również składają oferty do tego projektu

    • Forbes
    • The New York Times
    • Time
    • Wall Street Journal
    • Times Online