Zamknięty

Neuro fuzzy systems

I need someone to design a neurofuzzy system for protein secondary structure prediction. Given a protein sequence it should output the secondary sequence of that protein sequence

For example if the protein sequence is KSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG the secondary structure should be CCCHHHCCCCHHHHHHHHHHHCCCCEEEEEECCCCEECCCCCCEEEEEEECCCCEECCCCEEC.

Umiejętności: Biotechnologia, Matlab i Mathematica, Inżynieria telekomunikacyjna

Zobacz więcej: neuro linguistic programming example, how to write a proposal for work example, general contract for services example, matlab & mathematica, cover page for resume example, cover letter for resume example, cover letter for job example, contract for services example, contract for service example, i want to design a logo for my new youtube channel about drones this is one example for the drones, i want to design a logo for my new youtube channel about ( drones ) this is one example for the drones, sharp neuro fuzzy, fuzzy neural network matlab example, neuro fuzzy system using, adaptive neuro fuzzy inference system, neuro fuzzy matlab mathematica, fuzzy neuro forecasting economic, forex code neuro fuzzy, php output example, neuro fuzzy

O pracodawcy:
( 1 ocena ) Dover, United States

Numer ID Projektu: #11760381

9 freelancerów złożyło ofertę na kwotę $317 do tego projektu

aminariaz

sir i can help u with this project i have done masters in computer engg with specilization in image processing and pattern recognition this is a dummy bid i can give u an exact estimate after we discuss the project hop Więcej

$155 USD w ciągu 3 dni
(102 Oceny)
6.1
zain437

Hi i can help you in this project. I have done projects on fuzzy logic. kindly share some more details so that i can further guide you. Thanks for considering my bid.

$222 USD w ciągu 7 dni
(15 Oceny)
4.9
smartresearch1

I am an expert in data mining and predictive modeling. I have a PhD in Physics and I have extensive experience in machine learning applications, statistics and software development (web, mobile, desktop, SaaS). I work Więcej

$800 USD w ciągu 12 dni
(5 Oceny)
4.4
sahanwa23

Hi! Im an electrical and electronic masters student studying in UWE. I have the experience of programming in C/C++/Assembly/Arduino/PIC C/MikroC/MATLAB for more than three years. I also have the knowledge and experie Więcej

$135 USD w ciągu 2 dni
(14 Oceny)
4.0
chyconsl

Hi, I have read and understood the project description and possess the skills required to meet your needs. Please give me a chance and reply. Thanks.

$833 USD w ciągu 10 dni
(6 Oceny)
4.0
hemantmayatra

Published 2 IEEE papers on endoscopic image restoration technique. 4 research papers pending for approval. [login to view URL] [login to view URL] Więcej

$200 USD w ciągu 3 dni
(5 Oceny)
2.3
pirouzbehrooz

I have M.Sc. in engineering and more than 10 years of experience as an engineer and researcher. More than 40 papers, seven books, and one standard. In my profile, I attached some of my papers and books and samples of m Więcej

$200 USD w ciągu 7 dni
(1 Ocena)
2.0
nigamkumar09

Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Pro Więcej

$155 USD w ciągu 3 dni
(0 Oceny)
0.0
nitulsodlan1702

Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Pro Więcej

$155 USD w ciągu 3 dni
(0 Oceny)
0.0